PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597086.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 212aa    MW: 24704.6 Da    PI: 9.9238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597086.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+v  +G+g+W++I r+ g++R++k+c++rw +yl
   XP_013597086.1 17 KGLWTVEEDSILRDYVLTHGKGQWNRIVRKTGLKRCGKSCRLRWINYL 64
                     678*******************************************97 PP

2Myb_DNA-binding605.3e-1970115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w ++l
   XP_013597086.1  70 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWSTHL 115
                      79********************.*********.***********9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4021264IPR017930Myb domain
SuperFamilySSF466892.46E-3015111IPR009057Homeodomain-like
SMARTSM007172.8E-131666IPR001005SANT/Myb domain
PfamPF002495.1E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-231871IPR009057Homeodomain-like
CDDcd001671.00E-92064No hitNo description
PROSITE profilePS5129427.18365119IPR017930Myb domain
SMARTSM007175.2E-1869117IPR001005SANT/Myb domain
PfamPF002499.3E-1870115IPR001005SANT/Myb domain
CDDcd001671.69E-1272115No hitNo description
Gene3DG3DSA:1.10.10.607.3E-2672118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0032880Biological Processregulation of protein localization
GO:0048629Biological Processtrichome patterning
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MRTRRRTEEE NHQEYKKGLW TVEEDSILRD YVLTHGKGQW NRIVRKTGLK RCGKSCRLRW  60
INYLSPNVNK GNFTEQEEDL IIRLHKLLGN RWSLIAKRVP GRTDNQVKNH WSTHLSKKNR  120
RGLSSAVKTT GEENYPPSLL ITAATASGHH QQDKICDKSF EGLVSASNGN KQKADLTHTN  180
DLSLYFKERN NFDSSNTFWF NDDDDFEMNH SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26171187107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1882090.0KF188209.1 Brassica villosa BVGL1 (BVGL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597086.11e-158PREDICTED: trichome differentiation protein GL1
SwissprotP279003e-98GL1_ARATH; Trichome differentiation protein GL1
TrEMBLA0A0D3DBZ21e-158A0A0D3DBZ2_BRAOL; Uncharacterized protein
STRINGBra025311.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27920.11e-99myb domain protein 0